Proteintech, 32662-1-AP, Prolactin Polyclonal antibody

Size: 20ul / 150ul The Prolactin (32662-1-AP) by Proteintech is a Polyclonal antibody targeting Prolactin in WB, IHC, IP, ELISA applications with reactivity to mouse, rat samples 32662-1-AP targets Prolactin in WB, IHC, IP, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse pituitary gland tissue, rat pituitary gland tissue Positive IP detected in: mouse pituitary gland tissue Positive IHC detected in: mouse pituitary gland tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Prolactin is also named as PRL and belongs to the somatotropin/prolactin family. The proteins encoded by PRL are secreted into the cell surroundings. And they are abundantly expressed in pituitary gland, adenohypophysis, decidua and testis. Indeed, chemically, prolactin appears in a multiplicity of posttranslational forms ranging from size variants to chemical modifications such as phosphorylation or glycosylation. It is not only synthesized in the pituitary gland, as originally described, but also within the central nervous system, the immune system, the uterus and its associated tissues of conception, and even the mammary gland itself (PMID: 11015620). Prolactin acts primarily on the mammary gland by promoting lactation (PMID: 30546056). The major form of prolactin found in the pituitary gland is 23 kDa, variants of prolactin have been characterized in many mammals, including humans. Of the cleaved forms that have been characterized, 14 kDa, 16 kDa, and 22 kDa prolactin variants have been most widely studied (PMID: 7937959) (PMID: 8425495). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0937 Product name: recombinant mouse Prolactin protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 32-228 aa of NP_035294.2 Sequence: LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC Predict reactive species Full Name: prolactin Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NP_035294.2 Gene Symbol: Prl Gene ID (NCBI): 19109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P06879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.