Proteintech, 32743-1-AP, Tnfsf18 Polyclonal antibody

Size: 20ul / 150ul The Tnfsf18 (32743-1-AP) by Proteintech is a Polyclonal antibody targeting Tnfsf18 in IHC, ELISA applications with reactivity to mouse samples 32743-1-AP targets Tnfsf18 in IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Tnfsf18 (Tumor necrosis factor ligand superfamily member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. Tnfsf18 regulates T cell activation and the positive regulation of NF-κB transcription factor activity. TNFSF18 has been implicated in various inflammatory conditions. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2850 Product name: Recombinant Mouse TNFSF18 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 47-173 aa of NM_183391.3 Sequence: TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 18 Calculated Molecular Weight: 20 kDa GenBank Accession Number: NM_183391.3 Gene Symbol: Tnfsf18 Gene ID (NCBI): 240873 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7TS55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.