Iright
BRAND / VENDOR: Proteintech

Proteintech, 32890-1-AP, ADAMTS19 Polyclonal antibody

CATALOG NUMBER: 32890-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAMTS19 (32890-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS19 in IHC, ELISA applications with reactivity to human, mouse samples 32890-1-AP targets ADAMTS19 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ADAMTS19 encodes a member of the ADAMTS (a disintegrin and metalloproteinase domain with thrombospondin motifs) protein family with emerging roles in carcinogenesis and metastasis. ADAMTS shares several distinct protein modules including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The promoter of ADAMTS19 is targeted by hypermethylation in a significant proportion of gastrointestinal cancers, particularly in BRAF-mutant cancers, and that this hypermethylation associates with transcriptional downregulation and reduces the in vitro migration capabilities of Colorectal cancer cells (PMID: 26634009). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36946 Product name: Recombinant human ADAMTS19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 580-750 aa of NM_133638 Sequence: CQEMQHVICTGLWCKVEGEKECRTKLDPPMDGTDCDLGKWCKAGECTSRTSAPEHLAGEWSLWSPCSRTCSAGISSRERKCPGLDSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGY Predict reactive species Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 19 Calculated Molecular Weight: 134kDa GenBank Accession Number: NM_133638 Gene Symbol: ADAMTS19 Gene ID (NCBI): 171019 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TE59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924