Proteintech, 32902-1-AP, GFOD1 Polyclonal antibody

Size: 20ul / 150ul The GFOD1 (32902-1-AP) by Proteintech is a Polyclonal antibody targeting GFOD1 in WB, ELISA applications with reactivity to human, mouse samples 32902-1-AP targets GFOD1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Glucose-fructose oxidoreductase domain 1 (GFOD1), may be linked to the development of ADHD. It plays a role in regulating oxidative stress in ADHD. GFOD1 may contribute to increased levels of oxidative stress specifically in the prefrontal cortex and cerebellar cortex regions and astrocytes affected by ADHD via up-regulation of the NF-κB p65/NOX2/oxidative stress axis (PMID: 40210145). There is a signal peptide at the N-terminal of this protein and the detected double strand in fetal human brain tissue is consistent with PMID: 38946427. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37656 Product name: Recombinant human GFOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-390 aa of BC119005 Sequence: APEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC Predict reactive species Full Name: glucose-fructose oxidoreductase domain containing 1 Calculated Molecular Weight: 390 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC119005 Gene Symbol: GFOD1 Gene ID (NCBI): 54438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NXC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.