Proteintech, 32904-1-AP, ZCWPW2 Polyclonal antibody

Size: 20ul / 150ul The ZCWPW2 (32904-1-AP) by Proteintech is a Polyclonal antibody targeting ZCWPW2 in WB, ELISA applications with reactivity to human samples 32904-1-AP targets ZCWPW2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ZCWPW2 (Zinc Finger CW-type and PWWP Domain Containing 2) is a protein containing CW-type zinc finger and PWWP domains. It mainly serves as a histone methylation "reader" protein that binds lysine 4 (H3K4me0, H3K4me1, H3K4me3) in different methylation states on histone H3, and is involved in the regulation of chromatin structure and gene expression. In addition, ZCWPW2 protein plays an important role in meiosis and germ cell development, and its function is closely related to PRDM9 protein, which may be a key interacting protein in the mechanism of double-strand break repair or recombination. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36666 Product name: Recombinant human ZCWPW2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-356 aa of BC094696 Sequence: VYSDDALSKENRVVCETEVLLKELEQMLQQALQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF Predict reactive species Full Name: zinc finger, CW type with PWWP domain 2 Observed Molecular Weight: 47 kDa GenBank Accession Number: BC094696 Gene Symbol: ZCWPW2 Gene ID (NCBI): 152098 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q504Y3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.