Proteintech, 32958-1-AP, LAMTOR4 Polyclonal antibody

Size: 20ul / 150ul The LAMTOR4 (32958-1-AP) by Proteintech is a Polyclonal antibody targeting LAMTOR4 in WB, IP, ELISA applications with reactivity to human samples 32958-1-AP targets LAMTOR4 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, PANC-1 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4 (LAMTOR4) is a protein belonging to the LAMTOR family and believed to be involved in cell cycle, proliferation, and growth (PMID: 29138253). LAMTOR4 has been reported as a regulator complex that acts as an activator of rapamycin complex 1 (mTORC1) by sensing changes in the levels of amino acids (PMID: 33429026). It might offer a strategy to inhibit tumor progression and metastasis in prostate cancer (PMID: 39125671). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39105 Product name: Recombinant human C7orf59 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC130553 Sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV Predict reactive species Full Name: chromosome 7 open reading frame 59 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC130553 Gene Symbol: C7orf59 Gene ID (NCBI): 389541 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q0VGL1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.