Iright
BRAND / VENDOR: Proteintech

Proteintech, 32975-1-AP, KDF1 Polyclonal antibody

CATALOG NUMBER: 32975-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KDF1 (32975-1-AP) by Proteintech is a Polyclonal antibody targeting KDF1 in WB, ELISA applications with reactivity to human samples 32975-1-AP targets KDF1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, Calu-3 cells, SK-BR-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37124 Product name: Recombinant human C1orf172 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-244 aa of NM_152365.2 Sequence: RDCLQRCGACVRGCSPCLSTEDSTEGTAEANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSLPSTFASSPRGSEEYYSFHESDLDLPEMGSGSMSSREIDVLIF Predict reactive species Full Name: chromosome 1 open reading frame 172 Calculated Molecular Weight: 44 kDa,398aa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_152365.2 Gene Symbol: C1orf172 Gene ID (NCBI): 126695 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NAX2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924