Proteintech, 33051-1-AP, ZNF365 Polyclonal antibody

Size: 20ul / 150ul The ZNF365 (33051-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF365 in WB, ELISA applications with reactivity to human samples 33051-1-AP targets ZNF365 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZNF365 is a direct p53 target that promotes genome stability. Germline polymorphisms in the ZNF365 locus are associated with increased cancer risk, including those associated with telomere dysfunction. On the mechanistic level, ZNF365 suppresses expression of a subset of common fragile sites, including telomeres. In the absence of ZNF365, defective telomeres engage in aberrant recombination of telomere ends, leading to increased telomere sister chromatid exchange and formation of anaphase DNA bridges, including ultra-fine DNA bridges, and ultimately increased cytokinesis failure and aneuploidy (PMID: 23776040). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37654 Product name: Recombinant human ZNF365 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-407 aa of BC070073 Sequence: MDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTVEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKSHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII Predict reactive species Full Name: zinc finger protein 365 Calculated Molecular Weight: 407 aa, 46 kDa Observed Molecular Weight: 52 kDa, 46kDa GenBank Accession Number: BC070073 Gene Symbol: ZNF365 Gene ID (NCBI): 22891 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q70YC5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.