Proteintech, 33150-1-AP, CCNB1IP1 Polyclonal antibody

Size: 20ul / 150ul The CCNB1IP1 (33150-1-AP) by Proteintech is a Polyclonal antibody targeting CCNB1IP1 in WB, ELISA applications with reactivity to human, rat samples 33150-1-AP targets CCNB1IP1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Cyclin-B1-interacting protein 1 (CCNB1IP1) is an interacting protein of cyclin B1 involved in regulating cell cycle progression, and may be implicated in tumour events (PMID: 12612082). CCNB1IP1 modulates cyclin-B levels and participates in the regulation of cell cycle progression through the G2 phase. Its overexpression causes delayed entry into mitosis (PMID: 12612082; 17297447). Additionally, CCNB1IP1 has been shown to stabilize the MYCN protein, which is a critical factor in neuroblastoma tumorigenesis (PMID: 37461251). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38148 Product name: Recombinant human CCNB1IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC004435 Sequence: MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI Predict reactive species Full Name: cyclin B1 interacting protein 1 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC004435 Gene Symbol: CCNB1IP1 Gene ID (NCBI): 57820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NPC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.