Proteintech, 33202-1-AP, PIM3 Polyclonal antibody

Size: 20ul / 150ul The PIM3 (33202-1-AP) by Proteintech is a Polyclonal antibody targeting PIM3 in WB, ELISA applications with reactivity to human, mouse samples 33202-1-AP targets PIM3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39664 Product name: Recombinant human PIM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-326 aa of BC141855 Sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL Predict reactive species Full Name: pim-3 oncogene Calculated Molecular Weight: 326 aa, 36 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC141855 Gene Symbol: PIM3 Gene ID (NCBI): 415116 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86V86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.