Proteintech, 33262-1-AP, ASB12 Polyclonal antibody

Size: 20ul / 150ul The ASB12 (33262-1-AP) by Proteintech is a Polyclonal antibody targeting ASB12 in WB, ELISA applications with reactivity to human, mouse, rat samples 33262-1-AP targets ASB12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse testis tissue, rat skeletal musle tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The ankyrin repeat and SOCS box (ASB) family is composed of 18 proteins from ASB1 to ASB18 and belongs to the suppressor of cytokine signaling (SOCS) box protein superfamily. ASB family proteins interact with Cul5-Rbx2 to form E3 Ub ligases and play significant roles via a ubiquitination-mediated pathway (PMID: 16325183). The calculated molecular weight of ASB12 in mice or rat was 34 kda. ASB12 may be ubiquitinated, resulting in an increase in the observed molecular quantity. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36991 Product name: Recombinant human ASB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 12-161 aa of BC069436 Sequence: LLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSGWGVPGTPLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGASPGGSIYNNCSPVLTAARDGAVAILQELLDHGAEANVKAK Predict reactive species Full Name: ankyrin repeat and SOCS box-containing 12 Calculated Molecular Weight: 309 aa, 34 kDa/318 aa, 35 kDa Observed Molecular Weight: 34,39 kDa GenBank Accession Number: BC069436 Gene Symbol: ASB12 Gene ID (NCBI): 142689 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WXK4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.