Product Description
Size: 20ul / 150ul
The TMCO2 (33338-1-AP) by Proteintech is a Polyclonal antibody targeting TMCO2 in WB, ELISA applications with reactivity to human, mouse, rat samples
33338-1-AP targets TMCO2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse testis tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag37348 Product name: Recombinant human TMCO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-182 aa of NM_001008740.3 Sequence: KRSIQSIQKTLLFVITLYKLYKKGSHIFEALLANPEGSGLRIQDNNNLFLSLGLQEKILKKLKTVENKMKNLEGIIVAQKPATKRDCSSEPYCSCSDCQSPLSTSGFTSPI Predict reactive species
Full Name: transmembrane and coiled-coil domains 2
Calculated Molecular Weight: 20kDa,182aa
Observed Molecular Weight: 20-25 kDa
GenBank Accession Number: NM_001008740.3
Gene Symbol: TMCO2
Gene ID (NCBI): 127391
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q7Z6W1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924