Iright
BRAND / VENDOR: Proteintech

Proteintech, 33386-1-AP, PON3 Polyclonal antibody

CATALOG NUMBER: 33386-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PON3 (33386-1-AP) by Proteintech is a Polyclonal antibody targeting PON3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 33386-1-AP targets PON3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse lung tissue, mouse pancreas tissue, rat liver tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PON3 (paraoxonase 3) is a member of the paraoxonase gene family and shares high homology with PON1 and PON2. The PON3 protein is primarily synthesized by the liver and can bind to high-density lipoprotein (HDL), where it exerts antioxidant functions. PON3 can prevent the oxidation of low-density lipoprotein (LDL) and disrupt bacterial quorum-sensing molecules. Additionally, PON3 is expressed in mouse models of Alzheimer's disease (AD), with positive staining for PON3 detected in astrocytes surrounding Aβ plaques. These findings suggest that PON3 plays an important role in antioxidant stress and lipid peroxidation and may have potential protective effects on pathological processes such as neurodegenerative diseases and atherosclerosis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2743 Product name: Recombinant Mouse Pon3 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-354 aa of NM_173006.1 Sequence: RLLNFRERVSTTREIKATEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPAFAPDKPGRIFLMDLNEQNPEAQALEISGGLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRMLIGTIFHKALYCDL Predict reactive species Full Name: paraoxonase 3 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_173006.1 Gene Symbol: Pon3 Gene ID (NCBI): 269823 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q62087 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924