Proteintech, 33436-1-AP, GGT6 Polyclonal antibody

Size: 20ul / 150ul The GGT6 (33436-1-AP) by Proteintech is a Polyclonal antibody targeting GGT6 in WB, IF/ICC, ELISA applications with reactivity to human samples 33436-1-AP targets GGT6 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, MCF-7 cells, MDA-MB-231 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Gamma-glutamyltransferase 6 (GGT6) is a membrane-bound extracellular enzyme encoded by the GGT6 gene on human chromosome 17p13.2. It belongs to the gamma-glutamyltransferase (GGT; EC 2.3.2.2) family, which catalyzes the cleavage of γ-glutamyl peptide bonds in glutathione and other peptides, transferring the γ-glutamyl moiety to various acceptors such as amino acids or water . Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35941 Product name: Recombinant human GGT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-493 aa of BC063111 Sequence: TNPQLAAVLRSAALAPTSDLAGDALLSLLAGDLGVEVPSAVPRPTLEPAEQLPVPQGILFTTPSPSAGPELLALLEAALRSGAPIPDPCPPFLQTAVSPESSALAAVDSSGSVLLLTSSLNCSFGSAHLSPSTGVLLSNLVAKSTTSAWACPLILRGSLDDTEADVLGLVASGTPDVARAMTHTLLRHLAARPPTQAQHQHQGQQEPTEHPSTCGQGTLLQVAAHTEHAHVSSVPHACCPFQGF Predict reactive species Full Name: gamma-glutamyltransferase 6 Observed Molecular Weight: 44 kDa, 51 kDa GenBank Accession Number: BC063111 Gene Symbol: GGT6 Gene ID (NCBI): 124975 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6P531 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.