Proteintech, 33489-1-AP, PTCHD4 Polyclonal antibody

Size: 20ul / 150ul The PTCHD4 (33489-1-AP) by Proteintech is a Polyclonal antibody targeting PTCHD4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 33489-1-AP targets PTCHD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PTCHD4 (Patched Domain-Containing Protein 4; formerly C6orf138) is a 96 kDa multi-pass transmembrane protein encoded at 6p12.3 that belongs to the Patched family of cholesterol/lipid transporters . Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37091 Product name: Recombinant human C6orf138 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-323 aa of BC137359 Sequence: SDGANIINLLASDSPSVSYAMVQQKYFSNYSPVIGFYVYEPLEYWNSSVQDDLRRLCSGFTAVSWVEQYYQFLKVSNVSANNKSDFISVLQSSFLKKPEFQHFRNDIIFSKAGDESNIIASRLYLVARTSRDKQKEITEVLEKLRPLSLSKSIRFIVFNPSFVFMDHYSLSVTV Predict reactive species Full Name: chromosome 6 open reading frame 138 Observed Molecular Weight: 90 kDa GenBank Accession Number: BC137359 Gene Symbol: C6orf138 Gene ID (NCBI): 442213 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ZW05 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.