Proteintech, 33561-1-AP, FAM108C1 Polyclonal antibody

Size: 20ul / 150ul The FAM108C1 (33561-1-AP) by Proteintech is a Polyclonal antibody targeting FAM108C1 in WB, ELISA applications with reactivity to human samples 33561-1-AP targets FAM108C1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, RT-4 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37831 Product name: Recombinant human FAM108C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-91 aa of BC059401 Sequence: RMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPAQATAAAAAAQPAPQQPEEGAGAGPGACSLHL Predict reactive species Full Name: family with sequence similarity 108, member C1 Calculated Molecular Weight: 329 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC059401 Gene Symbol: FAM108C1 Gene ID (NCBI): 58489 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6PCB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.