Proteintech, 33581-1-AP, IPO5 Polyclonal antibody

Size: 20ul / 150ul The IPO5 (33581-1-AP) by Proteintech is a Polyclonal antibody targeting IPO5 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 33581-1-AP targets IPO5 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, rat skeletal muscle tissue, rat testis tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information IPO5 is a member of the importin beta family. Structurally, the protein adopts the shape of a right-hand solenoid and is composed of 24 HEAT repeats. IPO5 facilitates cytoplasmic polyadenylation element-binding protein CPEB3 translocation by binding to the RRM1 motif of CPEB3 in neurons. NMDAR signaling increases RanBP1 expression and reduces the level of cytoplasmic GTP-bound Ran. These changes enhance CPEB3-IPO5 interaction, which consequently accelerates the nuclear import of CPEB3 and promotes its nuclear function. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30955 Product name: Recombinant human IPO5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-150 aa of BC001497 Sequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA Predict reactive species Full Name: importin 5 Observed Molecular Weight: 120-124 kDa GenBank Accession Number: BC001497 Gene Symbol: IPO5 Gene ID (NCBI): 3843 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00410 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.