Iright
BRAND / VENDOR: Proteintech

Proteintech, 33682-1-AP, TMEM260 Polyclonal antibody

CATALOG NUMBER: 33682-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM260 (33682-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM260 in WB, ELISA applications with reactivity to human samples 33682-1-AP targets TMEM260 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38950 Product name: Recombinant human C14orf101 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 512-707 aa of NM_017799.3 Sequence: EVNKQKETFVCIGIHEGDPTWKKNYSLWPWGSCDKLVPLEIVFNPEEWIKLTKSIYNWTEEYGRFDPSSWESVANEEMWQARMKTPFFIFNLAETAHMPSKVKAQLYAQAYDLYKEIVYLQKEHPVNWHKNYAIACERMLRLQARDADPEVLLSETIRHFRLYSQKAPNDPQQADILGALKHLRKELQSLRNRKNV Predict reactive species Full Name: chromosome 14 open reading frame 101 Calculated Molecular Weight: 80 kDa,707aa Observed Molecular Weight: 80 kDa GenBank Accession Number: NM_017799.3 Gene Symbol: C14orf101 Gene ID (NCBI): 54916 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NX78 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924