Product Description
Size: 20ul / 150ul
The ACBD7 (33855-1-AP) by Proteintech is a Polyclonal antibody targeting ACBD7 in ELISA applications with reactivity to human samples
33855-1-AP targets ACBD7 in ELISA applications and shows reactivity with human samples.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag40829 Product name: Recombinant human ACBD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC029526 Sequence: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI Predict reactive species
Full Name: acyl-Coenzyme A binding domain containing 7
Calculated Molecular Weight: 88 aa, 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC029526
Gene Symbol: ACBD7
Gene ID (NCBI): 414149
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q8N6N7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924