Proteintech, 50430-2-AP, GFP tag Polyclonal antibody

Size: 150ul The GFP tag (50430-2-AP) by Proteintech is a Polyclonal antibody targeting GFP tag in WB, IF/ICC, IF-P, IP, ELISA applications with reactivity to aequorea victoria, recombinant protein samples 50430-2-AP targets GFP tag in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA applications and shows reactivity with aequorea victoria, recombinant protein samples. Tested Applications Positive WB detected in: recombinant protein, Transfected HEK-293 cells Positive IP detected in: Transfected HEK-293T cells Positive IF-P detected in: transgenic mouse brain tissue Positive IF/ICC detected in: Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages.Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm.When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.This antibody is a rabbit polyclonal antibody, generated against the full-length eGFP protein. It exhibits reactivity towards variants of Aequorea victoria GFP, including S65T-GFP, RS-GFP, YFP, CFP, and eGFP. Specification Tested Reactivity: aequorea victoria, recombinant protein Cited Reactivity: mouse, rat, pig, canine, yeast, escherichia coli, silkworm Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2128 Product name: Recombinant aequorea victoria GFP tag protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of M62653 Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK Predict reactive species Full Name: GFP tag Calculated Molecular Weight: 26 kDa GenBank Accession Number: M62653 RRID: AB_11042881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42212 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.