Proteintech, 51013-2-AP, GRHPR Polyclonal antibody

Size: 20ul / 150ul The GRHPR (51013-2-AP) by Proteintech is a Polyclonal antibody targeting GRHPR in WB, IHC, ELISA applications with reactivity to human, mouse samples 51013-2-AP targets GRHPR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, human liver tissue, L02 cells, MCF-7 cells Positive IHC detected in: human liver tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GRHPR(Glyoxylate reductase/hydroxypyruvate reductase) is also named as GLXR and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The GRHPR gene encodes a predicted 328-amino acid protein with a calculated molecular mass of 35.5 kD. It has glyoxylate reductase (GR), hydroxypyruvate reductase (HPR) and D-glycerate dehydrogenase (DGDH) activities(PMID:16597637). Defects in GRHPR are the cause of hyperoxaluria primary type 2 (HP2)(PMID: 10484776). It can exsit as a homodimer(PMID:16756993). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0484 Product name: Recombinant human GRHPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-328 aa of BC000605 Sequence: VGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL Predict reactive species Full Name: glyoxylate reductase/hydroxypyruvate reductase Calculated Molecular Weight: 328 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC000605 Gene Symbol: GRHPR Gene ID (NCBI): 9380 RRID: AB_2113424 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.