Proteintech, 60078-1-Ig, GDI2 Monoclonal antibody

Size: 20ul / 150ul The GDI2 (60078-1-Ig) by Proteintech is a Monoclonal antibody targeting GDI2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 60078-1-Ig targets GDI2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI2 distributes ubiquitously, displaying a membrane bound location in perinuclear regions of cells. GDI-2 was thought to be involved in cellular response to insulin. It electrophoreses as a 46kd protein in SDS-PAGE. (PMID: 7929030; PMID: 19570034). This antibody can bind both GDIs for the close sequences. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4613 Product name: Recombinant human GDI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-234 aa of BC005145 Sequence: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGEL Predict reactive species Full Name: GDP dissociation inhibitor 2 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC005145 Gene Symbol: GDI2 Gene ID (NCBI): 2665 RRID: AB_2232457 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P50395 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.