Proteintech, 60094-2-Ig, PFN2 Monoclonal antibody

Size: 20ul / 150ul The PFN2 (60094-2-Ig) by Proteintech is a Monoclonal antibody targeting PFN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 60094-2-Ig targets PFN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human lung cancer tissue, human skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information PFN2 (profilin 2) is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. The MW of this protein is 15 kDa, and this antibody specially recognises the 15 kDa protein. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5043 Product name: Recombinant human PFN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC018049 Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF Predict reactive species Full Name: profilin 2 Calculated Molecular Weight: 140 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC018049 Gene Symbol: PFN2 Gene ID (NCBI): 5217 RRID: AB_2163215 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35080 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.