Proteintech, 60231-1-Ig, FAF1 Monoclonal antibody

Size: 20ul / 150ul The FAF1 (60231-1-Ig) by Proteintech is a Monoclonal antibody targeting FAF1 in WB, ELISA applications with reactivity to human, mouse, rat samples 60231-1-Ig targets FAF1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FAF1 was detected most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon, but not in the peripheral blood leukocytes.The N-terminal region (amino acid 1∼201) including the upstream ubiquitin homology domain of hFAF1 could bind with the death domain of Fas, which mediates programmed cell death, also called apoptosis, in a number of organ systems, notably the immune and nervous systems. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0407 Product name: Recombinant human FAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-489 aa of BC004970 Sequence: RSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTA Predict reactive species Full Name: Fas (TNFRSF6) associated factor 1 Calculated Molecular Weight: 650aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC004970 Gene Symbol: FAF1 Gene ID (NCBI): 11124 RRID: AB_11232212 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UNN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.