Proteintech, 60242-1-Ig, OCT4/POU5F1 Monoclonal antibody

Size: 20ul / 150ul The OCT4/POU5F1 (60242-1-Ig) by Proteintech is a Monoclonal antibody targeting OCT4/POU5F1 in WB, ELISA applications with reactivity to human, mouse, rat samples 60242-1-Ig targets OCT4/POU5F1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Caki-2 cells, human brain tissue, NIH/3T3 cells, HT-1376 cells, NCCIT cells, L02 cells, Neuro-2a cells, mMSCs cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Background Information BackgroundOctamer-binding protein 4 (OCT4), also known as POU5F1 or OCT3/4, is a member of the POU gene family and encoded by the human gene POU5F1 (POU domain class 5 transcription factor 1). OCT4 is a member of the Octamer class of transcription factors that recognize the 8-base pair consensus motif 5'-ATGCAAAT-3'. Expression of OCT4 is associated with an undifferentiated, pluripotent stem cell phenotype and tumors. OCT4 is also expressed in the developing brain, with the highest levels found in the cortex, olfactory bulb, and the hippocampus.What is the molecular weight of OCT4?The molecular weight of OCT4 is 38 kDa.What are the isoforms of OCT4?The human POU51F gene consists of five exons located on chromosome 6 and can generate three mRNA isoforms through alternative splicing - OCT4A, OCT4B, and OCT4B1 (PMID: 18787205). OCT4A and OCT4B1 orchestrate gene transcription in the nucleus supporting self-renewal and pluripotency maintenance in ESCs and embryonal carcinoma cells, whereas OCT4B is localized in the cytoplasm in various non-pluripotent cell types and cannot sustain self-renewal and pluripotency.What is OCT4's involvement in pluripotency and self-renewal?OCT4 forms a trimeric complex with SOX2 and DNA to control the expression of genes involved with embryonic development, such as FGF4 (PMID: 10801796), UTF1 (PMID: 10409735), or even NANOG (PMID: 15743839). OCT4 is critical for early embryogenesis (PMID: 9814708) and for embryonic stem cell pluripotency (PMID: 16153702). High levels of OCT4 are associated with the ability to self-renew, which is emphasized by OCT4 gene knockdowns promoting differentiation (PMID: 10742100). OCT4 is also one of the four key transcription factors used to generate induced pluripotent stem cells (iPSCs) by reprogramming fibroblasts to a pluripotent state (PMID: 16904174). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1794 Product name: Recombinant human OCT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-265 aa of BC020712 Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN Predict reactive species Full Name: POU class 5 homeobox 1 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 50-52 kDa GenBank Accession Number: BC020712 Gene Symbol: POU5F1 Gene ID (NCBI): 5460 RRID: AB_2881364 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q01860 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.