Proteintech, 60298-1-Ig, IL-36RN Monoclonal antibody

Size: 20ul / 150ul The IL-36RN (60298-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-36RN in WB, ELISA applications with reactivity to human samples 60298-1-Ig targets IL-36RN in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information IL36RN is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). It inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3780 Product name: Recombinant human IL-1F5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC024747 Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD Predict reactive species Full Name: interleukin 1 family, member 5 (delta) Calculated Molecular Weight: 155 aa, 17 kDa GenBank Accession Number: BC024747 Gene Symbol: IL-36RN Gene ID (NCBI): 26525 RRID: AB_2881413 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UBH0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.