Proteintech, 60353-1-Ig, MUM1 Monoclonal antibody

Size: 20ul / 150ul The MUM1 (60353-1-Ig) by Proteintech is a Monoclonal antibody targeting MUM1 in WB, IF/ICC, ELISA applications with reactivity to human samples 60353-1-Ig targets MUM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A375 cells, Jurkat cells Positive IF/ICC detected in: HeLa cells, A375 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MUM1, also named as EXPAND1, is an architectural component of the chromatin, which in response to DNA damage serves as an accessory factor to promote cell survival. It is a 53BP1-associated DNA damage-responsive factor. MUM1/EXPAND1 is different to another protein IRF4/MUM1. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3371 Product name: Recombinant human MUM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC008098 Sequence: MLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVKYLQGVYQEVGAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQLLEERNRRRR Predict reactive species Full Name: melanoma associated antigen (mutated) 1 Calculated Molecular Weight: 18 kDa, 79 kDa Observed Molecular Weight: 78-80 kDa GenBank Accession Number: BC008098 Gene Symbol: MUM1 Gene ID (NCBI): 84939 RRID: AB_2881462 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q2TAK8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.