Iright
BRAND / VENDOR: Proteintech

Proteintech, 60466-1-Ig, TAX1BP1 Monoclonal antibody

CATALOG NUMBER: 60466-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TAX1BP1 (60466-1-Ig) by Proteintech is a Monoclonal antibody targeting TAX1BP1 in WB, ELISA applications with reactivity to human, mouse samples 60466-1-Ig targets TAX1BP1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, U2OS cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TAX1BP1 (also named as T6BP and TXBP151) inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. It is degraded by caspase-3-like family proteins upon TNF-induced apoptosis. TAX1BP1 may also play a role in the pro-inflammatory cytokine IL-1 signaling cascade. TAX1BP1 binds TRAF6 but not TRAFs 1-5. TAX1BP1 has 4 isoforms, this antibody recognizes both TXBP151-L and TXBP151-S. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6279 Product name: Recombinant human TAX1BP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 454-789 aa of BC050358 Sequence: KECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD Predict reactive species Full Name: Tax1 (human T-cell leukemia virus type I) binding protein 1 Calculated Molecular Weight: 91 kDa Observed Molecular Weight: 68 kDa, 85 kDa GenBank Accession Number: BC050358 Gene Symbol: TAX1BP1 Gene ID (NCBI): 8887 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86VP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924