Proteintech, 60551-1-Ig, CD47 Monoclonal antibody

Size: 20ul / 150ul The CD47 (60551-1-Ig) by Proteintech is a Monoclonal antibody targeting CD47 in IF/ICC, FC, ELISA applications with reactivity to human samples 60551-1-Ig targets CD47 in IF/ICC, FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells, A431 cells, Jurkat cells Positive FC detected in: human PBMCs Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC): FC : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Eg31499 Product name: Recombinant Human CD47 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 19-139 aa of BC010016 Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVCVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP Predict reactive species Full Name: CD47 molecule Calculated Molecular Weight: 323 aa, 35 kDa GenBank Accession Number: BC010016 Gene Symbol: CD47 Gene ID (NCBI): 961 RRID: AB_3670268 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q08722 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.