Proteintech, 61022-1-Ig, PURB Monoclonal antibody

Size: 20ul / 150ul The PURB (61022-1-Ig) by Proteintech is a Monoclonal antibody targeting PURB in WB, IHC, ELISA applications with reactivity to human, mouse, rat, rabbit samples 61022-1-Ig targets PURB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: A549 cells, LNCap cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, C2C12 cells, pig brain tissue, rabbit brain tissue Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PURB (Purine-rich element-binding protein B) is a ubiquitously expressed DNA/RNA-binding protein. It localizes to both the nucleus and cytoplasm, reflecting its dual role in transcriptional regulation and RNA metabolism. Its primary function is to bind purine-rich sequences to control gene expression, cell cycle progression, and differentiation. The observed molecular weight of PURB by SDS-PAGE is 33-40 kDa, which is close to its predicted molecular weight of ~33 kDa. Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12816 Product name: Recombinant human PURB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-312 aa of BC101735 Sequence: MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED Predict reactive species Full Name: purine-rich element binding protein B Calculated Molecular Weight: 312 aa, 33 kDa Observed Molecular Weight: 33-40 kDa GenBank Accession Number: BC101735 Gene Symbol: PURB Gene ID (NCBI): 5814 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96QR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.