Proteintech, 66030-1-Ig, Serpin A5/Protein C Inhibitor Monoclonal antibody

Size: 20ul / 150ul The Serpin A5/Protein C Inhibitor (66030-1-Ig) by Proteintech is a Monoclonal antibody targeting Serpin A5/Protein C Inhibitor in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66030-1-Ig targets Serpin A5/Protein C Inhibitor in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Human testis, tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human ovary tumor tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information SERPINA5 (also called Protein C Inhibitor, PCI ) is a serpin type of serine protease inhibitor that is found in many tissues and fluids in human, including blood plasma, seminal plasma and urine. PCI found in blood originates from the liver and is capable of inhibiting several serine proteases involved in the regulation of coagulation and fibrinolysis, including activated protein C, thrombin, factor Xa, various kallikreins and plasminogen activators. PCI has been found to have antimicrobial and antitumor properties and thus appears to be a multi-functional protein. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18094 Product name: Recombinant human SERPINA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 106-406 aa of BC008915 Sequence: ELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC008915 Gene Symbol: SERPINA5 Gene ID (NCBI): 5104 RRID: AB_11045661 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05154 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.