Proteintech, 66162-1-Ig, IFN Alpha Monoclonal antibody

Size: 20ul / 150ul The IFN Alpha (66162-1-Ig) by Proteintech is a Monoclonal antibody targeting IFN Alpha in WB, ELISA applications with reactivity to human samples 66162-1-Ig targets IFN Alpha in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein, Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information IFNA1 (IF-alpha) is a member of the Type I IFN (1) family best known for their antiviral activity. It is a key cytokine regulating the activity of B cells, T-helper cells (Th cells), cDCs and natural killer cells (NK cells). IFNA1 induces B cell maturation into plasma cells and immunoglobulin production. IFNA1 plays an important role in the pathogenesis of systemic lupus erythematosus (SLE). IFNA1 was the first cytokine to show clinical benefit in the treatment of certain types of cancer, including melanoma, chronic myelogenous leukemia, and renal cancer. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12533 Product name: Recombinant human IFNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-189 aa of BC074928 Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE Predict reactive species Full Name: IFNA1 Calculated Molecular Weight: 189 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC074928 Gene Symbol: IFN alpha1 Gene ID (NCBI): 3439 RRID: AB_2881558 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01562 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.