Proteintech, 66163-1-Ig, IL-29 Monoclonal antibody

Size: 20ul / 150ul The IL-29 (66163-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-29 in WB, ELISA applications with reactivity to human samples 66163-1-Ig targets IL-29 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Interleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages. IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12444 Product name: Recombinant human IL-29 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-200 aa of BC074985 Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST Predict reactive species Full Name: interleukin 29 (interferon, lambda 1) Calculated Molecular Weight: 200 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC074985 Gene Symbol: IL-29 Gene ID (NCBI): 282618 RRID: AB_2881559 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8IU54 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.