Iright
BRAND / VENDOR: Proteintech

Proteintech, 66231-2-Ig, CD68 Monoclonal antibody

CATALOG NUMBER: 66231-2-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD68 (66231-2-Ig) by Proteintech is a Monoclonal antibody targeting CD68 in IHC, IF-P, ELISA applications with reactivity to human samples 66231-2-Ig targets CD68 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:6000 Immunofluorescence (IF)-P: IF-P : 1:3000-1:12000 Background Information CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages. Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22815 Product name: Recombinant human CD68 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-319 aa of BC015557 Sequence: SATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS Predict reactive species Full Name: CD68 molecule Calculated Molecular Weight: 37 kDa GenBank Accession Number: BC015557 Gene Symbol: CD68 Gene ID (NCBI): 968 RRID: AB_2881622 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P34810 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924