Proteintech, 66242-1-Ig, C4 Gamma Chain Monoclonal antibody

Size: 20ul / 150ul The C4 Gamma Chain (66242-1-Ig) by Proteintech is a Monoclonal antibody targeting C4 Gamma Chain in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 66242-1-Ig targets C4 Gamma Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular wights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1543-1744aa of human C4-A protein recognizes C4 gamma chain. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10449 Product name: Recombinant human C4A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-202 aa of BC012372 Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV Predict reactive species Full Name: complement component 4A (Rodgers blood group) Calculated Molecular Weight: 1744 aa, 193 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC012372 Gene Symbol: C4 Gamma Chain Gene ID (NCBI): 720 RRID: AB_2881631 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P0C0L4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.