Proteintech, 66250-1-Ig, C-Reactive Protein/CRP Monoclonal antibody

Size: 20ul / 150ul The C-Reactive Protein/CRP (66250-1-Ig) by Proteintech is a Monoclonal antibody targeting C-Reactive Protein/CRP in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 66250-1-Ig targets C-Reactive Protein/CRP in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: serum from mouse injected with bacteria, pig liver tissue, rat liver tissue, serum from mouse injected with bacteria tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, monkey Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9883 Product name: Recombinant human CRP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-91 aa of BC020766 Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP Predict reactive species Full Name: C-reactive protein, pentraxin-related Calculated Molecular Weight: 224 aa, 25 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC020766 Gene Symbol: CRP Gene ID (NCBI): 1401 RRID: AB_2881638 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02741 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.