Proteintech, 66251-1-Ig, 14-3-3 Sigma Monoclonal antibody

Size: 20ul / 150ul The 14-3-3 Sigma (66251-1-Ig) by Proteintech is a Monoclonal antibody targeting 14-3-3 Sigma in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66251-1-Ig targets 14-3-3 Sigma in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A-253 cells, A431 cells, HeLa cells, MCF-7 cells, HT-1376 cells, HaCaT cells, SCaBER cells, MCF-10A cells, MDA-MB-468 cells Positive IHC detected in: human skin tissue, human breast cancer tissue, human breast hyperplasia tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information 14-3-3 Sigma is a member 14-3-3 family of highly conserved proteins participating in diverse cellular processes including cell cycle progression. It is exclusively present in various epithelial cells, and alternatively named as human epithelial marker (HEM), or stratifin. Alteration of its expression has been linked to cancer. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12644 Product name: Recombinant human SFN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-248 aa of BC002995 Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS Predict reactive species Full Name: stratifin Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC002995 Gene Symbol: 14-3-3 Sigma Gene ID (NCBI): 2810 RRID: AB_2881639 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P31947 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.