Proteintech, 66269-1-Ig, L2HGDH Monoclonal antibody

Size: 20ul / 150ul The L2HGDH (66269-1-Ig) by Proteintech is a Monoclonal antibody targeting L2HGDH in WB, IHC, IF-P, ELISA applications with reactivity to human, pig samples 66269-1-Ig targets L2HGDH in WB, IHC, IF-P, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig brain tissue, MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information L2HGDH(L-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as duranin, C14orf160 and belongs to the L2HGDH family. The putative L2HGDH is predicted to be targeted to the mitochondria where its mitochondrial targeting sequence is presumably removed(PMID:16005139). Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA). It has 2 isoforms produced by alternative splicing with the molecular weight of 50 kDa and 48 kDa. L2HGDH also can be detected as ~45kD due to the 51aa transit peptide cleaved. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8382 Product name: Recombinant human L2HGDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC006117 Sequence: MVPALRYLVGACGRARGRFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDI Predict reactive species Full Name: L-2-hydroxyglutarate dehydrogenase Calculated Molecular Weight: 463aa,50 kDa; 441aa,49 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC006117 Gene Symbol: L2HGDH Gene ID (NCBI): 79944 RRID: AB_2881654 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H9P8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.