Proteintech, 66321-1-Ig, Fascin Monoclonal antibody

Size: 20ul / 150ul The Fascin (66321-1-Ig) by Proteintech is a Monoclonal antibody targeting Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human samples 66321-1-Ig targets Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HeLa cells, K-562 cells Positive IHC detected in: human tonsillitis tissue, human pancreas cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6074 Product name: Recombinant human Fascin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS Predict reactive species Full Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC000521 Gene Symbol: Fascin Gene ID (NCBI): 6624 ENSEMBL Gene ID: ENSG00000075618 RRID: AB_2881701 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16658 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.