Proteintech, 66323-2-Ig, Glutamine Synthetase Monoclonal antibody

Size: 20ul / 150ul The Glutamine Synthetase (66323-2-Ig) by Proteintech is a Monoclonal antibody targeting Glutamine Synthetase in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66323-2-Ig targets Glutamine Synthetase in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human liver cancer tissue, human liver tissue, mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue, mouse brain tissue Positive IF-Fro detected in: mouse liver tissue Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat, canine Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6309 Product name: Recombinant human Glutamine synthetase protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-373 aa of BC011700 Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN Predict reactive species Full Name: glutamate-ammonia ligase (glutamine synthetase) Calculated Molecular Weight: 374 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC011700 Gene Symbol: Glutamine Synthetase Gene ID (NCBI): 2752 RRID: AB_2881704 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P15104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.