Proteintech, 66343-1-Ig, CLIC4 Monoclonal antibody

Size: 20ul / 150ul The CLIC4 (66343-1-Ig) by Proteintech is a Monoclonal antibody targeting CLIC4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, rat, pig samples 66343-1-Ig targets CLIC4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: HuH-7 cells, pig heart tissue, HeLa cells, U2Os cells, pig kidney tissue, rabbit kidney tissue, rat kidney tissue, mouse kidney tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: BT-549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIC4 is a p53- and tumor necrosis factor alpha-regulated cytoplasmic and mitochondrial protein that belongs to the CLIC family of intracellular chloride channels. CLICs have actions distinct from traditional cell membrane chloride channels, including formation of ion channels in intracellular organelles and roles in membrane trafficking, apoptosis, and cell differentiation. Specification Tested Reactivity: human, rat, pig Cited Reactivity: rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2942 Product name: Recombinant human CLIC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC012444 Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK Predict reactive species Full Name: chloride intracellular channel 4 Calculated Molecular Weight: 253 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC012444 Gene Symbol: CLIC4 Gene ID (NCBI): 25932 RRID: AB_2881723 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y696 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.