Proteintech, 66378-1-Ig, Occludin Monoclonal antibody

Size: 20ul / 150ul The Occludin (66378-1-Ig) by Proteintech is a Monoclonal antibody targeting Occludin in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 66378-1-Ig targets Occludin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HUVEC cells, Jurkat cells, mouse colon tissue, LNCaP cells, U2OS cells, pig colon tissue, rat colon tissue, 4T1 cells, HEK-293 cells Positive IHC detected in: human colon cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, canine, bovine, sheep Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4057 Product name: Recombinant human Occludin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-522 aa of BC029886 Sequence: RKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species Full Name: occludin Calculated Molecular Weight: 522 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC029886 Gene Symbol: Occludin Gene ID (NCBI): 4950 RRID: AB_2881755 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.