Proteintech, 66401-1-Ig, NDP52 Monoclonal antibody

Size: 20ul / 150ul The NDP52 (66401-1-Ig) by Proteintech is a Monoclonal antibody targeting NDP52 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66401-1-Ig targets NDP52 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Caco-2 cells, MDA-MB-231 cells, Jurkat cells, MOLT-4 cells, K-562 cells, Karpas-299 cells, human skeletal muscle tissue Positive IHC detected in: human ovary tumor tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information NDP52, also named as CALCOCO2, is an autophagy receptor. It plays a role in ruffle formation and actin cytoskeleton organization. Mouse/Rat NDP52 has some isoforms with MW 28-40 kDa and 67 kDa. Human NDP52 has some isoforms with MW 43-47 kDa and 52-55 kDa, Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2866 Product name: Recombinant human CALCOCO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-283 aa of BC015893 Sequence: MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLE Predict reactive species Full Name: calcium binding and coiled-coil domain 2 Calculated Molecular Weight: 446 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC015893 Gene Symbol: NDP52 Gene ID (NCBI): 10241 RRID: AB_2881775 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.