Proteintech, 66471-1-Ig, TFF2 Monoclonal antibody

Size: 20ul / 150ul The TFF2 (66471-1-Ig) by Proteintech is a Monoclonal antibody targeting TFF2 in WB, ELISA applications with reactivity to human, pig, rat samples 66471-1-Ig targets TFF2 in WB, ELISA applications and shows reactivity with human, pig, rat samples. Tested Applications Positive WB detected in: rat pancreas tissue, pig pancreas tissue, pig stomach tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. Specification Tested Reactivity: human, pig, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18765 Product name: Recombinant human TFF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species Full Name: trefoil factor 2 Calculated Molecular Weight: 129 aa, 14 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC032820 Gene Symbol: TFF2 Gene ID (NCBI): 7032 RRID: AB_2881837 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03403 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.