Proteintech, 66681-1-Ig, ERC1 Monoclonal antibody

Size: 20ul / 150ul The ERC1 (66681-1-Ig) by Proteintech is a Monoclonal antibody targeting ERC1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 66681-1-Ig targets ERC1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ERC is an acronym based on previous separate namings of members of this protein family, ELKS, Rab6IP2 and CAST (PMID: 12391317). They are known to bind RIMs, the active zone proteins that regulate neurotransmitter release. ERC1 (ELKS) is an essential regulatory subunit of the IKK complex and likely functions by recruiting IκBα to the complex (PMID: 15218148). Multiple isoforms of ERC1 mRNA are generated by alternative splicing (PMID: 12203787). There are two known splice variants of ERC1 protein that differ at their C termini, ERC1a and ERC1b. ERC1a is ubiquitously expressed, whereas ERC1b is brain-specific (PMID: 12391317; 12923177). Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: canine Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17665 Product name: Recombinant human ERC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 985-1116 aa of BC132782 Sequence: DNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS Predict reactive species Full Name: ELKS/RAB6-interacting/CAST family member 1 Calculated Molecular Weight: 1116 aa, 128 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC132782 Gene Symbol: ERC1 Gene ID (NCBI): 23085 RRID: AB_2882035 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8IUD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.