Proteintech, 66695-1-Ig, TNFAIP3 Monoclonal antibody

Size: 20ul / 150ul The TNFAIP3 (66695-1-Ig) by Proteintech is a Monoclonal antibody targeting TNFAIP3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66695-1-Ig targets TNFAIP3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, HEK-293 cells, HepG2 cells, Jurkat cells Positive IHC detected in: rat kidney tissue, human thyroid cancer tissue, mouse kidney tissue, rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information TNFAIP3, also named A20, is a cytoplasmic zinc finger protein that inhibits nuclear factor kappa-B (NFKB) activity and tumor necrosis factor (TNF)-mediated programmed cell death. A20 is a ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities, and involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through terminating NF-kappa-B activity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18150 Product name: Recombinant human TNFAIP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 441-790 aa of BC114480 Sequence: EAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG Predict reactive species Full Name: tumor necrosis factor, alpha-induced protein 3 Calculated Molecular Weight: 790 aa, 90 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC114480 Gene Symbol: TNFAIP3 Gene ID (NCBI): 7128 RRID: AB_2882048 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21580 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.