Proteintech, 66777-1-Ig, TOM20 Monoclonal antibody

Size: 20ul / 150ul The TOM20 (66777-1-Ig) by Proteintech is a Monoclonal antibody targeting TOM20 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66777-1-Ig targets TOM20 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, THP-1 cells, K-562 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information TOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms. Specification Tested Reactivity: human Cited Reactivity: human, monkey, chicken, bovine Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species Full Name: translocase of outer mitochondrial membrane 20 homolog (yeast) Calculated Molecular Weight: 145 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC000882 Gene Symbol: TOM20 Gene ID (NCBI): 9804 RRID: AB_2882123 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15388 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.