Proteintech, 66904-1-Ig, Glucocorticoid receptor Monoclonal antibody

Size: 20ul / 150ul The Glucocorticoid receptor (66904-1-Ig) by Proteintech is a Monoclonal antibody targeting Glucocorticoid receptor in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 66904-1-Ig targets Glucocorticoid receptor in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, MCF-7 cells, Jurkat cells, K-562 cells, PC-12 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28431 Product name: Recombinant human Glucocorticoid receptor protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC015610 Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI Predict reactive species Full Name: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC015610 Gene Symbol: Glucocorticoid receptor Gene ID (NCBI): 2908 RRID: AB_2857354 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P04150 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.