Proteintech, 66909-1-Ig, Carbonic Anhydrase 6/CA6 Monoclonal antibody

Size: 20ul / 150ul The Carbonic Anhydrase 6/CA6 (66909-1-Ig) by Proteintech is a Monoclonal antibody targeting Carbonic Anhydrase 6/CA6 in WB, ELISA applications with reactivity to human samples 66909-1-Ig targets Carbonic Anhydrase 6/CA6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information CA6 (Carbonic anhydrase VI ) is a member of CA family proteins that play a central role in pH regulation and electrolyte balance. CA6 is also known as gustin, is a zinc-containing secreted protein which catalyzes the hydration of carbon hydroxide in saliva. CA6 is specifically expressed in the salivary gland of a number of mammalian species (PMID:28423504). The amino acid sequences are highly conserved across the species. And it was reported that decreasing of CA6 protein was associated with loss of taste and pathological morphology of taste buds (PMID: 9784398). Specification Tested Reactivity: human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24274 Product name: Recombinant human CA6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-86 aa of BC034350 Sequence: QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHT Predict reactive species Full Name: carbonic anhydrase VI Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC034350 Gene Symbol: CA6 Gene ID (NCBI): 765 RRID: AB_2882236 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23280 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.