Proteintech, 66928-1-Ig, CFTR Monoclonal antibody

Size: 20ul / 150ul The CFTR (66928-1-Ig) by Proteintech is a Monoclonal antibody targeting CFTR in WB, IHC, ELISA applications with reactivity to human, mouse, rat, rabbit samples 66928-1-Ig targets CFTR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: Calu-3 cells, HEK-293T cells, HeLa cells, HT-29 cells, Caco-2 cells, MCF-7 cells, MOLT-4 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue, A431 cells, A375 cells, A549 cells, NCI-H1299 cells, HepG2 cells Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information CFTR is a member of the ATP-binding cassette (ABC) family of membrane transport proteins, functioning as a chloride channel responsible for ion flow across epithelial surfaces of lung, sinuses, pancreas, intestine, and liver. Mutations of CFTR cause cystic fibrosis (CF), a disorder affecting the respiratory, digestive, reproductive systems and sweat glands. Specification Tested Reactivity: human, mouse, rat, rabbit Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27810 Product name: Recombinant human CFTR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-80 aa of NM_000492 Sequence: MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWR Predict reactive species Full Name: cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) Calculated Molecular Weight: 168 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: NM_000492 Gene Symbol: CFTR Gene ID (NCBI): 1080 RRID: AB_2882254 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P13569 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.